PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS508047.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family B3
Protein Properties Length: 113aa    MW: 12805.7 Da    PI: 12.0438
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS508047.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B364.31.9e-208763199
                  .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
            B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                  ++++ l + d  g++W++++ y+++s +yvlt+GW +Fvk++ L++gD++ F+++   e++l++   r+
  EcS508047.10  8 PKGTLLNFIDGGGKVWRFRYLYWNSSHSYVLTRGWTRFVKEKSLRAGDIISFHRSAGPEKQLHINYMRR 76
                  5678899**********************************************9877888888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.915177IPR003340B3 DNA binding domain
SMARTSM010190.0051277IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-21776IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.37E-19876IPR015300DNA-binding pseudobarrel domain
PfamPF023628.4E-17876IPR003340B3 DNA binding domain
CDDcd100171.75E-141762No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
NRSSPTTPKG TLLNFIDGGG KVWRFRYLYW NSSHSYVLTR GWTRFVKEKS LRAGDIISFH  60
RSAGPEKQLH INYMRRSGLS QARPVHPVQK VRLFGVNIFQ VSGTGRGVNC GGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A1e-3037844119DNA-binding protein RAV1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010040940.11e-63PREDICTED: AP2/ERF and B3 domain-containing transcription repressor TEM1-like
SwissprotP822801e-36RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2
TrEMBLA0A059CBR52e-65A0A059CBR5_EUCGR; Uncharacterized protein
STRINGPOPTR_0008s11600.13e-43(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84827121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.28e-38related to ABI3/VP1 2