![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EcS508047.10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 113aa MW: 12805.7 Da PI: 12.0438 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 64.3 | 1.9e-20 | 8 | 76 | 31 | 99 |
.--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 ++++ l + d g++W++++ y+++s +yvlt+GW +Fvk++ L++gD++ F+++ e++l++ r+ EcS508047.10 8 PKGTLLNFIDGGGKVWRFRYLYWNSSHSYVLTRGWTRFVKEKSLRAGDIISFHRSAGPEKQLHINYMRR 76 5678899**********************************************9877888888887776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 12.915 | 1 | 77 | IPR003340 | B3 DNA binding domain |
SMART | SM01019 | 0.0051 | 2 | 77 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 1.7E-21 | 7 | 76 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 8.37E-19 | 8 | 76 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 8.4E-17 | 8 | 76 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 1.75E-14 | 17 | 62 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 113 aa Download sequence Send to blast |
NRSSPTTPKG TLLNFIDGGG KVWRFRYLYW NSSHSYVLTR GWTRFVKEKS LRAGDIISFH 60 RSAGPEKQLH INYMRRSGLS QARPVHPVQK VRLFGVNIFQ VSGTGRGVNC GGR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wid_A | 1e-30 | 3 | 78 | 44 | 119 | DNA-binding protein RAV1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010040940.1 | 1e-63 | PREDICTED: AP2/ERF and B3 domain-containing transcription repressor TEM1-like | ||||
Swissprot | P82280 | 1e-36 | RAV2_ARATH; AP2/ERF and B3 domain-containing transcription repressor RAV2 | ||||
TrEMBL | A0A059CBR5 | 2e-65 | A0A059CBR5_EUCGR; Uncharacterized protein | ||||
STRING | POPTR_0008s11600.1 | 3e-43 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM848 | 27 | 121 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68840.2 | 8e-38 | related to ABI3/VP1 2 |